Instant Pot Cheeseburger Macaroni Recipes

facebook share image   twitter share image   pinterest share image   E-Mail share image

INSTANT POT® HOMEMADE HAMBURGER MAC



Instant Pot® Homemade Hamburger Mac image

A quick and easy dish for a weeknight. While the pressure is building you can make a side salad and have dinner on the table in 45 minutes. You can add 1 cup of shredded medium cheddar cheese to the pot, I don't due to allergies. Enjoy!

Provided by Bren

Categories     Main Dish Recipes     Pasta

Time 40m

Yield 6

Number Of Ingredients 10

1 pound lean ground beef
1 cup finely diced onion
2 tablespoons taco seasoning mix
1 tablespoon minced garlic
1 teaspoon dried parsley
½ teaspoon chili powder
2 cups beef broth
2 cups canned diced tomatoes, with juices
2 cups elbow macaroni
½ cup sour cream

Steps:

  • Turn on a multi-functional pressure cooker (such as Instant Pot®) and select Saute function. Add beef and saute, breaking meat up as it cooks, until browned, about 5 minutes. Remove beef and drain in a colander to remove excess fat.
  • Return beef to Instant Pot® and add onion. Cook for 3 minutes. Add taco seasoning, garlic, parsley, and chili powder; cook and stir for 1 minute. Add a dash of beef broth to deglaze the pot, scraping up any brown bits. Add remaining broth and tomatoes. Stir to combine. Mix in macaroni, stirring until noodles are completely submerged in liquid. Close and lock the lid. Turn off Saute mode.
  • Select high pressure according to manufacturer's instructions; set timer for 3 minutes. Allow 10 to 15 minutes for pressure to build.
  • Release pressure using the natural-release method according to manufacturer's instructions, for 5 minutes. Release remaining pressure carefully using the quick-release method, about 5 minutes. Unlock and remove the lid. Serve with a dollop of sour cream.

Nutrition Facts : Calories 360.1 calories, Carbohydrate 34.5 g, Cholesterol 58 mg, Fat 14 g, Fiber 2.3 g, Protein 21.5 g, SaturatedFat 6.3 g, Sodium 669.6 mg, Sugar 4.6 g

More about "instant pot cheeseburger macaroni recipes"

2021-06-16 How to Make this Cheeseburger Macaroni Recipe – Step by Step. Make Marinade: First, set instant pot …
From itisakeeper.com

2018-11-28 RESOURCES TO MAKE Instant Pot Cheeseburger Macaroni recipe and more. We are a participant in the Amazon Services LLC Associates Program, an affiliate advertising program designed to provide a means for us to earn fees by linking to Amazon.com and affiliated sites. My Instant Pot …
From simplyhappyfoodie.com

2019-09-23 Stir to combine. Add dry pasta and combine. Add water and salt. Stir, trying to keep as much pasta as possible under the water. Use the manual setting to cook for 5 minutes. When done, use the quick release on the pressure cooker. Remove the lid and turn off the power. Add the shredded cheese.
From ourbestbites.com

2018-07-27 Instant Pot Cheeseburger Macaroni Is a Quick, Easy, and Delicious Lunch or Dinner for Your Family! We love Instant Pot Ground Beef recipes! Some of our favorites include Instant Pot Ground Beef Enchilada Pasta and Instant Pot Ground Beef Stroganoff.
From sidetrackedsarah.com

2018-10-12 Recipe for Instant Pot Cheeseburger Macaroni (Homemade Hamburger Helper) Instant Pot Cheeseburger Macaroni. Published by Dee. Instant Pot cheeseburger macaroni is homemade Hamburger Helper made with ground beef and pasta in a creamy cheese sauce. This quick and easy dinner is super kid friendly! 5 from 30 votes. Print Recipe …
From meatloafandmelodrama.com

2018-11-23 If your family loves Hamburger Helper, they are going to love this Instant Pot cheeseburger pasta recipe. Made with ground beef, macaroni, and two types of cheese, it is sure to be a family favorite. Best of all, this recipe …
From crayonsandcravings.com

2020-04-13 Instant Pot Cheeseburger Macaroni Recipe …
From sweetandsavorymeals.com

2019-03-07 Use a wooden spoon to break up into fine pieces. Add the macaroni to the pot and then pour over the beef stock. Make sure as much of the noodles are covered as possible, but do not stir. Cover the pressure cooker and lock lid in place. Ensure sealing valve is set to SEAL, and set the pot …
From gogogogourmet.com

2021-03-04 Instant Pot Cheeseburger Macaroni Recipe. March 4, 2021 by Tiffany Davis 4 Comments. Weeknights can be hectic and the last thing you want to worry about is a home cooked meal! This Cheeseburger Macaroni Recipe is a one pot dish that is quicker than drive through and infinitely more delicious! If your family loves mac ‘n cheese they will love this homemade pasta dish. Rich and creamy, it is ...
From imperfectlyhappy.com

2020-01-28 If you’ve tried this Instant Pot Cheeseburger Macaroni recipe, don’t forget to rate the recipe and leave me a comment below. I love to hear from people who’ve made my recipes! You can FOLLOW ME on PINTEREST for even more delicious food. Print Pin. 5 from 1 vote. Instant Pot Cheeseburger Macaroni . Easy Instant Pot Cheeseburger Macaroni! This quick recipe …
From cookdinnertonight.com

2019-03-04 Instant Pot Cheeseburger Macaroni Homemade Hamburger Helper Recipe is an awesome almost effortless, homemade hamburger helper.. It’s one kid approved recipe …
From by-pink.com

2019-01-20 Steps to make Instant Pot Cheeseburger Macaroni. Add the oil …
From julieseatsandtreats.com

2019-08-15 My Instant Pot has really helped to simplify mealtime, allowing many of our favorite meals to easily become one-pot meals that are ready in minutes.. This Instant Pot cheeseburger macaroni is one of those meals.. It’s one of my favorite Instant Pot ground beef recipes …
From marginmakingmom.com

2018-02-20 Your family is going to love this Instant Pot Cheeseburger Macaroni recipe. Course: Pasta Servings: 4 people. Author: A Mom's Impression. Ingredients. 1 lbs ground beef; 1 onion chopped; 1 tbs minced garlic; 1 teaspoon basil; 2 tsp Italian seasoning; 1 tbs seasoning salt; 3 cups beef broth; 2 15-ounce cans tomato sauce; 1 28 oz can diced tomatoes; 2 cups elbow macaroni uncooked; 1 cup shredded ...
From amomsimpression.com

2019-05-23 A childhood favourite made from scratch, this homemade cheeseburger macaroni recipe is delicious, comforting and super easy to make right in the Instant Pot®! 5 from 11 votes Print Recipe Save Recipe …
From girlheartfood.com

2020-02-07 However, I'm telling you this Instant Pot Cheeseburger Macaroni recipe will be ready before your pizza will be delivered. It will take less than 30 minutes to make this recipe from start to finish. It's all made in the one pot…
From petersfoodadventures.com

2019-12-06 Set a 6-qt Instant Pot® to the …
From damndelicious.net

Macaroni and Cheese - Instant Pot Recipes new recipes.instantpot.com. Combine the macaroni, broth, and butter in the Instant Pot. Secure the lid and …
From listalternatives.com

Sep 17, 2019 - Instant Pot Cheeseburger Macaroni is comfort food that tastes great! Pressure cooker cheeseburger macaroni is cheesy, and delicious! A great …
From pinterest.ca

2021-08-16 Instant Pot Cheeseburger Macaroni is a quick and easy family recipe. It's cheesy and beefy and it's even better than Hamburger Helper. In fact, if you're a Hamburger Helper family, you may never go back. This post contains affiliate links. As an Amazon Associate, I earn from qualifying purchases.
From bykelseysmith.com

2019-07-23 Instant Pot cheeseburger macaroni. Saute. Add olive oil, diced onions, ground beef or sausage into …
From temeculablogs.com

2022-01-18 Easy Instant Pot Cheeseburger Macaroni! This quick recipe takes just a few ingredients and about 20 minutes to make a delicious weeknight dinner. Macaroni and cheese is one of my family’s favorite dinners. And it’s so quick and easy to make, especially in the Instant Pot! This Instant Pot Cheeseburger Macaroni …
From eatinginaninstant.com

2020-05-29 Sausage Breakfast Casserole. Cinnamon Roll Cake. Chocolate Waffles. Banana Streusel Muffins. Soups. Instant Pot Ham, Potato, and Corn Chowder. Instant Pot Creamy Chicken Tortilla Soup. Instant Pot Cheeseburger …
From mamaofmanyblessings.com

2020-04-13 · Instant Pot Cheeseburger Macaroni Recipe Tips: Use quality meat because a good meat-centered meal starts with quality meat. Preferably use …
From tfrecipes.com

Instant Pot Mac and Cheese with Bacon Recipe | MyRecipes great www.myrecipes.com. The Instant Pot's pressure function allows you to skip the entire process of boiling water, cooking, and draining the pasta saving valuable time over a traditional stovetop mac and cheese recipe…
From therecipes.info

2019-11-05 Sweet Potatoes in the Instant Pot; Easy Cheeseburger Macaroni Recipe… When sharing this recipe with you, I’m keeping in mind that a lot of you may desire a different level of seasonings and spices and I want to keep it as easy as possible. So expect this to be a very basic recipe …
From fantabulosity.com

Are you curently on diet or you just want to control your food's nutritions, ingredients? We will help you find recipes by cooking method, nutrition, ingredients...
Check it out »

You'll also love

GERMAN BUTTER COOKIES_image GERMAN BUTTER COOKIES

Mediterranean Grilled Tuna Sandwich_image Mediterranean Grilled Tuna Sandwich

Donna's 123 Sausage Balls_image Donna's 123 Sausage Balls

Helen Hoie's Braised Brussels Sprouts_image Helen Hoie's Braised Brussels Sprouts

Hot Chocolate Concentrate from America's Test Kitchen_image Hot Chocolate Concentrate from America's Test Kitchen

Virgin Bahama Mama Punch Recipe - (4.2/5)_image Virgin Bahama Mama Punch Recipe (4.2/5)

Swedish Maple Salmon_image Swedish Maple Salmon

Chicken Zucchini Quesadillas_image Chicken Zucchini Quesadillas

Chicken Ranch Tacos_image Chicken Ranch Tacos

Butternut-Pineapple Crumble_image Butternut Pineapple Crumble

Shrimp and Smoked Sausage Jambalaya_image Shrimp and Smoked Sausage Jambalaya

Patriotic Trifle_image Patriotic Trifle

Ruby Rum Buck_image Ruby Rum Buck

Mocha Bread Pudding with Caramel Topping_image Mocha Bread Pudding with Caramel Topping

Pomegranate Cooler_image Pomegranate Cooler

BEET SALAD WITH GORGONZOLA CHEESE_image BEET SALAD WITH GORGONZOLA CHEESE

Marinara, Seafood Pasta_image Marinara, Seafood Pasta

Okroshka (Ukrainian Version)_image Okroshka (Ukrainian Version)

Tuscan Vegetable Soup_image Tuscan Vegetable Soup

Barbara's Cheesy Potatoes_image Barbara's Cheesy Potatoes

Related Search

Chinese Barbecued Pork

Crock Pot Sausage Pasta Stew

Gatorade Margarita

Herb Crumbed Broiled Tomatoes

Maple Syrup Roasted Tomatoes

Quickandeasychickeninaparmesanwhitesauce

Rogan Josh 2

Sarahkaye's Spicy Chicken Tortilla Soup

Simpleorzosalad